DPCstruct | MC32601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 180 ± 35 aa |
| Standard deviation of domain lengths | 35.12 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A522Q345 | 132-321 | YDVSQLWTTAGALGFIGAGYQRLQVHFLSMKKDPNDPAVYLVVGKTLVRNRVREFKGKIVIETVVEFPAQDDGCERSVKGLTEGVIT… |
| A0A163ACV3 | 21-212 | LDFVNLWTQTKNYNVLGIIGSNHQRIKIKFLSIKKDSINSNKYLVSGKSSVKETICDFKGTIILRDIKEVEKLHFGVDNEHQNKGIK… |
| A0A1W2GKD0 | 9-197 | None |
| A0A3S4UJM6 | 14-146 | None |
| I8YL30 | 19-176 | None |
| A0A519YS11 | 50-290 | None |
| A0A7D4FVT1 | 3-134 | None |
| A0A840ENQ0 | 29-243 | None |
| A0A4Z0PKJ4 | 70-259 | None |
| A0A8B2AQT2 | 9-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.