DPCstruct | MC3260
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 208 ± 31 aa |
| Standard deviation of domain lengths | 30.84 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379T0V7 | 1-228 | MGCWNGKKEGDKYCVETIAQKDYEELEQELREIFLRDDSPVLQIGDVWKAKSPIELLYQLAPRLTESQLKRFFLVVKQTLLKPDPAL… |
| A0A290RUU6 | 21-214 | VNKNRDVALLALVGGWLESNQYDKQLIETLVKEPYEKWIERIRGYRDDLVGYVDYEEQRWSVSNREVLWSKYAPYLYEEHLRDFKKV… |
| A0A5E6N9Z8 | 21-228 | None |
| A0A2I8EZF8 | 388-574 | None |
| A0A5C5BXJ3 | 252-430 | None |
| A0A2V5VVA8 | 1-166 | None |
| A0A0M2UYY1 | 375-573 | None |
| D4CUA1 | 1-266 | None |
| A0A355YGP1 | 350-581 | None |
| A0A3N5XA68 | 2-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.