DPCstruct | MC326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 128 ± 12 aa |
| Standard deviation of domain lengths | 12.05 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K3EHW7 | 1-117 | MQQYTYDDFLRDHCTALESMKVPELYWPALHSKLLGKEFDVPQHFELGLLNYTDPESGDVVDKELFVSVKSDEILSSDSDSIFLIDH… |
| A0A183GT54 | 1-126 | MEFGGYHFEHFLQGHKDQLEAGGIPPELWGSLYSKLMQQTFDAGNYFRILCEEAEDGRNWSVLATKDLHPVDEYNVFLIDHAWTFRP… |
| A0A2M4AH23 | 2-132 | None |
| A0A4S4CYV4 | 1-120 | None |
| B4NS67 | 7-134 | None |
| A0A3B4AKU4 | 15-147 | None |
| A0A1E5UUF6 | 14-154 | None |
| A0A5D2C3W0 | 5-129 | None |
| A0A2G3BZ67 | 1-127 | None |
| A0A2G5BAU3 | 4-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.