DPCstruct | MC32599
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 218 ± 32 aa |
| Standard deviation of domain lengths | 32.46 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 21.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A655BVR7 | 82-269 | SFQPGDVVYGLCKARDRVNTLVNSLYYFSKKDIIIQNTLTDAVWDRKNRAVFNKDEKIAERLNDVQRGTFFREFLSQHKKYNITEDK… |
| A0A839KHY1 | 212-396 | PGDIVYGLSSPREKLVNSIKLVNDFSKKDIVIQNTLTNAVWDARPPRKYKQDSLIKRALNEHERGTKFKQCLKNHNNYNVIMADLSI… |
| A0A1I3N6B7 | 17-285 | None |
| A0A329H4K8 | 33-300 | None |
| A0A364K088 | 10-200 | None |
| A0A855BNT1 | 59-288 | None |
| A0A4R1IFN6 | 43-346 | None |
| A0A7U9QC68 | 165-349 | None |
| A0A2D0JSM9 | 32-268 | None |
| A0A2S7C602 | 11-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.