DPCstruct | MC32590
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 148 ± 19 aa |
| Standard deviation of domain lengths | 19.17 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 16.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M4SXW1 | 6-177 | KGQTVKMWKDMDKDFSLRYQLGRLTKDDLKEIVKSYEIKGVSKLKKDELIETIIVNILNKISTTLETISDDNKNLIKNIINASGILD… |
| A0A1N6RWF1 | 10-164 | LDNIEPDACYNQLLSNFTKNELNEIRKLWDFHGISQLNKAELIQELTKRIADNLESWLQYLGSEQTEFLKEIIMQCEKYSAAYIEIN… |
| A0A7C7QTI8 | 2-156 | None |
| A0A7C2ALH5 | 256-430 | None |
| A0A847AWL2 | 14-158 | None |
| A0A523DNI3 | 3-137 | None |
| E1I9S0 | 1-151 | None |
| A0A0F2PY05 | 45-185 | None |
| A0A518B8W6 | 254-395 | None |
| A0A5D4RWD7 | 10-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.