DPCstruct | MC3259
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 248 ± 32 aa |
| Standard deviation of domain lengths | 31.52 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D0F9Z8 | 1-229 | DQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQGSTARQLAAVPSSADPSRTTVAYVDGTAGNIEIPEKLLNTGSLGGILTF… |
| A0A379SXK1 | 1-279 | MAQINNYAKQIANLNDQISRLTGVGAGASPNDLLDQRDQLVSELNKIVGVEVSVQDGGTYNLTMANGYTLVQGATARQLAAVPSSAD… |
| A0A7C3AS12 | 78-369 | None |
| A0A7R9N5X1 | 62-314 | None |
| A0A432UX44 | 16-211 | None |
| A0A258RJ08 | 169-450 | None |
| A0A7C2K6S1 | 2-259 | None |
| A0A349EEZ9 | 2-234 | None |
| A0A090TPQ1 | 2-232 | None |
| A0A090QVG6 | 57-323 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.