DPCstruct | MC32586
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 236 ± 21 aa |
| Standard deviation of domain lengths | 21.06 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817UM98 | 2-221 | ANQSGDFNSINTWNNNIRPQNNSTVIIPSYITVYISNESHLNVNIQSFKIYGKLQIGSPNISFLTTSFKFSYSINIMIFNGGLLEDL… |
| A0A817UR58 | 1-269 | MFIIFLLCFVILLTEIKSLTIIANQSGDFNCLNTWSNNIQTGNDSTVIIPSDISVYISNESHLNMSIQSLKIYGNLQIGSPYSSNSI… |
| A0A814CIM1 | 202-432 | None |
| A0A817YZP8 | 33-268 | None |
| A0A819UJJ6 | 116-369 | None |
| A0A814B8T9 | 30-267 | None |
| A0A813ZXJ6 | 2-262 | None |
| A0A821SFQ9 | 199-412 | None |
| A0A817NY91 | 1-202 | None |
| A0A822DBR8 | 1-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.