DPCstruct | MC32581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 216 ± 18 aa |
| Standard deviation of domain lengths | 17.63 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.82 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A316YYP9 | 1-229 | MFKRITKHNERLEKDREEGLAVGHEAPPEMAIDDDSDSDSESENEAEIDDDDKHSEGSNSGNNASNEEDDQDDEDGQSDSGAGSEAE… |
| A0A4S4KGH3 | 1-224 | MFKRVEKRRRKQEEEEELGLDGDMKEVLGLQDTDSEESDSSDDEDPSGSEEEAGANDADDVSDKEEMSDGGLQSVEEDEEEEDKLPP… |
| A0A0H2R9C6 | 32-206 | None |
| I2G080 | 15-248 | None |
| A0A317XMP8 | 1-227 | None |
| A0A5C3MWM4 | 50-263 | None |
| A0A369JWZ2 | 1-206 | None |
| A0A0C3B7Y1 | 29-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.