DPCstruct | MC3258
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 88 ± 6 aa |
| Standard deviation of domain lengths | 6.04 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 40.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0T9QMF1 | 65-156 | NELTIPFRHPADLFDGGLESAWEMSVSRKSIPKTVRVNDDNYPHAQSDMMGVTETNLDYPALLAEDYRWGEYYAESGDEYSNEPGQG… |
| A0A379SUT2 | 1-81 | MRLPYREPSGLFDGAAESVWDVRTWHNIATGTVTTRDYNYRTASTPMDAAVSVRNDAVTTGEYYRYAAPYREAGDDSSPEP |
| A0A6G2GFX4 | 40-126 | None |
| A0A6S5XSP0 | 4-92 | None |
| A0A653RSE3 | 197-293 | None |
| K8D6U5 | 31-110 | None |
| A0A379U039 | 81-176 | None |
| A0A7H4NHU5 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.