DPCstruct | MC32577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 134 ± 11 aa |
| Standard deviation of domain lengths | 11.40 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0493 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A846KRU5 | 1-107 | LAGFMLAYLEIFFRKYIPQSISMIFVPLFSLLPTVLAAHVILGPIGWTVGSWISNIVNTGLTSSISWLFSAVFGFLYAPLVITGLHH… |
| R6ZFD7 | 3-121 | GYQGQVLPAILAAFTLVYLEKFFRKITPQVVSMIVVPFFSLLLSVMAAHFVLGSIGWKVGEAVSTLVFSGITGSFKIVFAAVFGVSY… |
| A0A380FDV5 | 9-138 | None |
| A0A4R8A5E4 | 258-391 | None |
| K9IDE1 | 175-316 | None |
| A0A0R2AGI4 | 114-264 | None |
| A0A1X3PAQ4 | 188-347 | None |
| W7CX65 | 178-315 | None |
| A0A2N0X9V5 | 83-222 | None |
| A0A6N6X748 | 14-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.