DPCstruct | MC32573
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 92 ± 11 aa |
| Standard deviation of domain lengths | 10.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 95.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6YN62 | 408-491 | TLNMTNQEADGDIVIDSISTLTMNLKEKSSFTGKINSENSAKSIKLVLDKNSKIKLTGDSYISSLEDEDSSYDNIDFNGYKLYV |
| A0A644ZJ92 | 22-107 | LSANDQTLSGDIVVDEQSAVSLLLKGDSSYTGTVNTANTAKAAKVTLEDGSTWTLTGNAYLTAFSGRVSSIVTNGFTVYVDGNPLS |
| A0A437UUM1 | 45-128 | None |
| R5XVA5 | 82-165 | None |
| A0A1C6C9N2 | 1-85 | None |
| A0A133ZDF5 | 174-267 | None |
| A0A0U3EAA0 | 17-116 | None |
| D4CMS8 | 112-219 | None |
| R5YTC6 | 59-142 | None |
| A0A645BWT6 | 3-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.