DPCstruct | MC3257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 124 ± 6 aa |
| Standard deviation of domain lengths | 6.35 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 94.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 51.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379SSY0 | 1-129 | MGLPPITDEEVEAATYAHGSKDMPERNIVEDIKFAQDIINKNRNGLEVVKALAKGGFPDVAQDMLNIQKAKLTGDYLHTSAIIVGSG… |
| A0A2X4Z8M1 | 308-435 | GLPPITDEEVEAATYAHGSKDMPERNIVEDIKFAQEIINKNRNGLEVVKALAQGGFTDVAQDMLNIQKAKLTGDYLHTSAIIVGDGQ… |
| A0A6M1HU73 | 1-113 | None |
| A0A1Q6XIP7 | 231-356 | None |
| A0A7R8WV17 | 160-268 | None |
| A0A7H4NXM8 | 61-188 | None |
| A0A0U1D1C7 | 119-245 | None |
| A0A6J6TPU3 | 38-164 | None |
| A0A645CJG5 | 160-286 | None |
| A0A6J7TT74 | 275-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.