DPCstruct | MC32566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 98 ± 10 aa |
| Standard deviation of domain lengths | 10.21 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.26 |
| Pfam Score | 83.04 |
| Assigned Pfam label(s) | CL0010- PF02979- PF21006 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N6JCU7 | 4-89 | TPGTRVRIRAWSPPGHIRTPNYLRGRTGIIERALGPFENPEQRAYALPAPKRELYRVRFSMAEIWGSDAERPEDTLDAEVYAHWLE |
| A0A808WBS7 | 63-156 | RVSPFQVGDHVRVSVRYPIGHYRTPFYLRGKPGQVVRVVEQYINPEQEAFGHNAGSQLWLYQVRFSQKDLWPENEGAPSDTLQLEIF… |
| A0A2R6E8Q0 | 154-246 | None |
| A0A812NNY8 | 998-1090 | None |
| A0A430DV63 | 276-369 | None |
| A0A2R6I616 | 130-227 | None |
| A0A7S3FLK0 | 98-205 | None |
| A0A7X1P7Y8 | 183-286 | None |
| A0A212TL16 | 1-80 | None |
| A0A0M3GIC3 | 315-410 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.