DPCstruct | MC32564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 9.21 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A8NZX3 | 35-139 | VQFPRDLPSEGLQELSGPTAAAIALAMEDFRPLGTKPHRNATPFEQCLYRREAFNVSAAPGADGVVFVRFSFSPTNCAEHEREIALD… |
| A0A3A8L497 | 12-102 | HLEGPVLAALEVAMNEFLPAGTEITTTDPDKRVAQCLSKRSSYDTHVLQAGEDLFFVWFSPDLSRCGLNVPILDGGAVYAIDARGRI… |
| A0A4Q5ZR34 | 10-102 | None |
| A0A3A8I9I9 | 34-127 | None |
| A0A085WFM6 | 1-82 | None |
| A0A3A5G8J9 | 1-87 | None |
| A0A250J8W0 | 56-148 | None |
| A0A0G2ZLG3 | 44-146 | None |
| A0A085W691 | 22-114 | None |
| A0A0H4X6V2 | 14-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.