DPCstruct | MC32563
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 95 ± 10 aa |
| Standard deviation of domain lengths | 10.40 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0091 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2N992 | 2-105 | QVAGPAEEQQLRSPAALTVHWVHRPGSLLDAVRTVPLPDATDQVFAWVAGEASAVRAVRRHLVGDRGLDKRAVAFTGYWRADLTQDD… |
| A0A7U9DRT3 | 1-91 | MEVVWLHRAGRPVGQALAEAVRALEFPEGRLHAFVHGEAACVKELRRYLRLEREIPREDLSISGYWRLGHNEDGWQASKREWNARVE… |
| A0A1Q2Z0Y1 | 31-120 | None |
| A0A2V4A6W7 | 54-141 | None |
| A0A7W1LR11 | 27-103 | None |
| X8FD91 | 46-157 | None |
| A0A212DLG5 | 1-101 | None |
| A0A812ZZ24 | 136-225 | None |
| A0A810L3F1 | 167-266 | None |
| A0A009PLF4 | 38-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.