DPCstruct | MC32561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 730 |
|---|---|
| Mean domain length (aa) | 173 ± 36 aa |
| Standard deviation of domain lengths | 36.37 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 14.62 |
| Pfam Score | 97.38 |
| Assigned Pfam label(s) | CL0023- CL0092- CL0349- CL0063- CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844WC64 | 26-131 | APNMIVCWGGHSINENEYLYARRVGTQLGLRELNICTGCGPGAMEAPMKGAAVGHAQQRYKDSRFIGMTEPSIIAAEPPNPLVNELI… |
| A0A1Y2MLH6 | 4-169 | SGEITLAGSRAASSYGAQVAADLAGELAAAGRTVIAGGGFGIEAAAVRGALAAHTPTVAVLGCGIDRAYPAAHENLLARIAETGLLV… |
| A0A1Q9C5Y3 | 313-466 | None |
| A0A6A6KZQ3 | 387-564 | None |
| A0A258KYN5 | 6-171 | None |
| A0A0D8XJ92 | 183-428 | None |
| A0A3T0K467 | 111-293 | None |
| A0A1F6ZA98 | 3-159 | None |
| A0A6P1AIU8 | 5-168 | None |
| J4UA61 | 7-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.