DPCstruct | MC32559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 120 ± 8 aa |
| Standard deviation of domain lengths | 8.32 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9YP69 | 307-425 | DGFDENVAFFTLTYESPWRVGTDRAFAAIAPMLWLRAGAVGRRIDSISNGWDVADSYGIINDLDQVADFIAALERVDGVRIAYIVTD… |
| A0A7K0X4A7 | 1-106 | MVRRGREFEAIAPLLWLEGGAQGERIAQEPEDGWALTEYYGILFSVDAMAPFAAAVSDAAQVDRAPRVVFIITDSPTEFQAAAERLP… |
| A0A8B4F7U2 | 124-250 | None |
| A0A7X6VCC4 | 1-99 | None |
| A0A3N2KGH0 | 348-470 | None |
| A0A391P531 | 3-128 | None |
| A0A410Q0A9 | 61-180 | None |
| A0A357A1D4 | 33-157 | None |
| A0A1V5GDZ0 | 109-228 | None |
| A0A7X9AIG1 | 178-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.