DPCstruct | MC32556
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 121 ± 20 aa |
| Standard deviation of domain lengths | 20.00 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W1A0I6 | 25-143 | QINRYATVANKPLAAQVNPLLAVQQIHFPQEVKTVGQAIEWWLQYSGYSLAVKEKQPQSLQAVMLQTLPQIDRNLGPLSVKDGLEVL… |
| A0A1H8T1Y1 | 23-132 | TQVGRYQTTAPLPTDSQIEPLQVRVTLTFPPEVETVGQAMGYALERSGYRLQSVDKADPAMKLLLTRALPESHRELGPMALETLLQT… |
| S2KEG4 | 64-195 | None |
| A0A0H3ZYP1 | 1-86 | None |
| A0A483AJV7 | 19-122 | None |
| A0A2E5FDE5 | 19-158 | None |
| A0A1B8NY09 | 1-89 | None |
| A0A420S100 | 35-178 | None |
| A0A2H0I8X2 | 94-218 | None |
| A0A379FI94 | 5-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.