DPCstruct | MC32554
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 144 ± 29 aa |
| Standard deviation of domain lengths | 28.62 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4JS18 | 1-112 | MRIIPLTLRITSYSAAPPEWPGRPTIHIEGGLAGQSNDLSDARRVHGKVEMVGNGDIRWSLCSEREDGDGEWQSEGVQLGGLGSATG… |
| A0A137QJ28 | 65-192 | DHRELIEYNKSIDEDTGELDTSLFEDDEFTEVFRRLEVKLKVTRVANDPDHPGRPIIGFVGEMIAPSNSAMYGCVQLMADNHLKWRF… |
| A0A370TZP2 | 79-243 | None |
| A0A1J8QEN4 | 262-404 | None |
| W4KRI3 | 279-414 | None |
| A0A395T264 | 338-456 | None |
| G4T680 | 300-466 | None |
| A0A834RLW0 | 969-1115 | None |
| A0A438MWS1 | 802-945 | None |
| A0A0G4M4D8 | 338-476 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.