DPCstruct | MC32553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 231 ± 28 aa |
| Standard deviation of domain lengths | 28.04 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A409WQ97 | 5-199 | FNHGSLIDMSLENDGAPWKFRHWQEKTGIPLAADSPYIPAAPSWGKDERAQVHSFFMQYQAKADANAKRAFSTISRQQVPGAGLWRD… |
| A0A401GRH1 | 1-220 | MPTVTLPGALLDLHAAEKDLWSWPTWATLVRTDHPPWSPEAEENPPEGWDANMVLAVRAFMEKYFNTKAKNRFDFMKRQTDEYSKGR… |
| M2P644 | 1-283 | None |
| A0A0D0DB79 | 1-227 | None |
| F8PEU1 | 58-273 | None |
| A0A4Q2D4Z8 | 1-224 | None |
| A0A4Q2D184 | 3-251 | None |
| A0A2G8S2J1 | 38-279 | None |
| A0A067PFU3 | 1-302 | None |
| A0A401GRG2 | 6-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.