DPCstruct | MC32552
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 436 ± 50 aa |
| Standard deviation of domain lengths | 50.25 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 71.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5Q8A8 | 37-542 | MPAVNNTFTTLVHRYTNGSPPAATNPCVWDSFPFTSPEFREHAGIESLKIGLSKPPVGRARDGLNSAVVEEWPKRAQGAMEFLRRCD… |
| A0A401GRG2 | 4-459 | APLSDAALWYDAWKYTGWQDFTGLPANPLTMSLEERRASGIMWNDDQLAAFAEYVEWVKQFKKPDDTMKKKSRTLSPRVQLGRGLWK… |
| M2P644 | 4-502 | None |
| F8PEU1 | 58-482 | None |
| F8P3B1 | 11-390 | None |
| A0A0H2R4L5 | 71-509 | None |
| B8PJ55 | 3-328 | None |
| A0A4Q2D184 | 5-456 | None |
| A0A4Q2D4Z8 | 1-462 | None |
| A0A2H3JIK2 | 6-399 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.