DPCstruct | MC32550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 233 ± 28 aa |
| Standard deviation of domain lengths | 27.90 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401GLY1 | 1-280 | MITCGDHVALVILKCIAIEEKSMRTTSVDDQSLSFPASGIKLIGQVLEMVEVGLCLPASEKMGPASNEDPNFSQTSTLTDTPAPDNS… |
| A0A0C3D6G9 | 177-408 | LVRTHNKALALAFVRSTHISQGGSACGHIKTATLMSPQDGIKVTGDIMVLRLSITSPIPSPESLWLWTGSYLKAASTVPGMQVKTTH… |
| A0A401GQD8 | 2-209 | None |
| R7SFJ0 | 258-496 | None |
| A0A4S8LQA7 | 52-257 | None |
| A0A0D0ACR3 | 103-319 | None |
| A0A6A4GQ23 | 6-208 | None |
| A0A4Y7T404 | 161-387 | None |
| A0A165H127 | 578-840 | None |
| A0A067M2F8 | 3-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.