DPCstruct | MC3255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 131 ± 14 aa |
| Standard deviation of domain lengths | 14.22 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U9NPA5 | 71-209 | YGTKAEYLAAIKALQREGIAVWADAVLDHRMGADGTEQVPATPYDWVDRYRQTGPARTISAWTSFTFPGRGGRYSDFCWNWEHFDGI… |
| A0A379SKD0 | 47-167 | VLLDVVVNHKMGADEKERIRVQRVSQDDRTQINDNIIECEGWTRYTFPARAGQYSNFIWDYHCFSGIDHIENPDEDGIVKIFNDYTG… |
| A0A379WRM8 | 40-182 | None |
| A0A364NBW5 | 92-233 | None |
| A0A6N6XC96 | 22-142 | None |
| A0A4Q4ZT28 | 446-547 | None |
| A0A2P6NU44 | 218-359 | None |
| A0A1C7M6K4 | 836-976 | None |
| A0A0G4M1A9 | 827-940 | None |
| A0A0F4GDH1 | 411-551 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.