DPCstruct | MC32545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 45 ± 2 aa |
| Standard deviation of domain lengths | 2.06 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 74.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00551 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2BIZ3 | 85-128 | LKLAIIGQSQFGQEVYTSLRKQGHKVVGVFTVPDKDGKADPLAM |
| A0A212C8W0 | 1-44 | MKIAVIGQSLFGQEVYCRLREEGHEVVGVFTVPDKDGKADPLGL |
| A0A3Q3AIY6 | 1-46 | None |
| A0A2J8TV46 | 1-46 | None |
| A0A0B1TI87 | 1-44 | None |
| A0A3Q2E213 | 1-44 | None |
| A0A3Q1GI24 | 23-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.