DPCstruct | MC32543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 157 ± 19 aa |
| Standard deviation of domain lengths | 18.89 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 54.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00992 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B3DJ40 | 2-164 | LKSLMAAKAKEDLEQELVEKEEQKAKYLEEKSPPVQTSGLSLAELQELCEELHTKIDVVDEERYDIEAKVLHNTREIKDLNIKVQDL… |
| H3BWX7 | 1-129 | MSQKKMTSSRRHHLKSLILQIAQNWLEQEKTETEKAKVAYMSEHCPSPDLSGDQAALMETCKKLHALIDKIDEERYDAEAKVTKADK… |
| A0A3Q0S3J0 | 17-177 | None |
| A0A4W2C4S2 | 93-272 | None |
| A0A6P4YXT7 | 5-173 | None |
| A0A556U3M1 | 126-253 | None |
| O01355 | 8-149 | None |
| A0A6I9Y6Y6 | 43-181 | None |
| A0A672FRX1 | 7-174 | None |
| A0A3Q3VUX6 | 25-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.