DPCstruct | MC3254
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 80 ± 8 aa |
| Standard deviation of domain lengths | 8.17 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V6Q1M1 | 8-78 | IAEQIGPRVEGVVYYDGPRLVRVESVITDPSESQRILKRRAAQFAVEVIDLHTGDRYPTGAVWTGSDRVIR |
| G8XFC7 | 29-106 | LTAERARHVHRRRVGPRRPGGVYTSGTDGETYVVLAVHYGADARAALGHPMGWAVTVRTADGRERTHCTPWDPRRDRV |
| A0A2U3C7G3 | 3-99 | None |
| A0A1A0IHH0 | 1-79 | None |
| A0A086H533 | 3-91 | None |
| A0A6N7L5D9 | 27-116 | None |
| A0A4Q9HYA7 | 2-85 | None |
| A0A2N3YU27 | 58-133 | None |
| A0A1H5PZB2 | 37-123 | None |
| A0A4S2U3D2 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.