DPCstruct | MC32533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 110 |
|---|---|
| Mean domain length (aa) | 269 ± 57 aa |
| Standard deviation of domain lengths | 56.67 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 72.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S0DPC7 | 390-621 | SRLYTMPPPGPGKGKEACPGESPASKSKYLALCVQTGPIYTTLKEFDTSSFKSDAALLQEMKSVYTRIRGARSKHNSLFIPIGLEFV… |
| G9N5N2 | 216-410 | SRNPIQPAYVVLGIFPSGHFNPKERIAFVHDPEKLFRELRWTIFRLRGWRSSLLSLRGVKRFRLFKCNAEDGTHERIHLDKNGDADL… |
| A0A4U0XW08 | 1-290 | None |
| A0A1V8SKY6 | 961-1253 | None |
| A0A178EG07 | 26-242 | None |
| A0A178ELV2 | 388-685 | None |
| A0A2T4ANZ9 | 775-1128 | None |
| A0A2V1CYS2 | 58-387 | None |
| A0A2V1D6X5 | 2-214 | None |
| A0A4Q9NAY2 | 25-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.