DPCstruct | MC32520
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 94 ± 6 aa |
| Standard deviation of domain lengths | 6.17 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.76 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A257FMP8 | 24-107 | LAGCEQLGIEDPAKVMAAKEAEGKAIGSACRHAMRAIEDCYTLNPKAHKASVFNGWKEMDEYMRENKLEGVAPIVPRPPKPGSP |
| A0A3S2WPW8 | 1-96 | MLGIPDPAKEAAAKEAEGKAIGSACRHAMRAIEDCYTLNPKAQKSAVYTGWREMDEYMRENKLEGVAPVVPRPEPKKAKKDDEEEAS… |
| A0A0J5GFQ4 | 21-109 | None |
| A0A554XFB1 | 44-140 | None |
| A0A084Y190 | 102-190 | None |
| A0A1I2H1R7 | 11-100 | None |
| A0A839A0D9 | 3-93 | None |
| A0A060NVP6 | 1-109 | None |
| A0A1V5QU96 | 52-147 | None |
| A0A658BJT8 | 17-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.