DPCstruct | MC3252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 406 |
|---|---|
| Mean domain length (aa) | 367 ± 56 aa |
| Standard deviation of domain lengths | 56.15 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 15.03 |
| Pfam Score | 92.61 |
| Assigned Pfam label(s) | CL0126- PF20774- CL0220- CL0159- CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A499VGY2 | 2-368 | IVVLVDFPDKELTATAQHFRDLFFSENTLEHGSVRDYFKEVTHGLVSISGEVVGPVTLPHTLAWYANNNFGIGRPSGEARANIMARD… |
| F8JWG2 | 38-418 | ALPRTDAWLSEGVTPWDDAHVRPLGTVRAAMVFVRFPDHVPRRAPRQVESAYLPSVPKFYLDASYGKARLAIDPVERWITLPRTAAG… |
| A0A534ZZC0 | 168-521 | None |
| A0A074MCT7 | 19-420 | None |
| A0A2H0YRS5 | 163-528 | None |
| A0A7K2B226 | 566-967 | None |
| A0A1I4ATV4 | 16-401 | None |
| A0A7C4GJB2 | 24-444 | None |
| A0A6J7VEN8 | 34-399 | None |
| A0A7X4BY19 | 73-418 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.