DPCstruct | MC32513
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 189 ± 33 aa |
| Standard deviation of domain lengths | 32.78 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.22 |
| Pfam Score | 98.61 |
| Assigned Pfam label(s) | PF04654- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2FRN8 | 8-225 | LHIAAIAFLVAAWATYAPLLGKFARGTLNTKLSIVRRRWIDLSMRRENRTFDAVMLGHIINSVAFFGSATLIVLAGIVGLFANAGHV… |
| A0A5J9VHY2 | 154-364 | VLVPLGVMALAVYHLWLLYTILRHPTRTVIGVNGMARKRWVSAMMANTEKNGVLAVQTLRNNIMASTVLATTAITLVSVISVFIGVT… |
| A0A1D1YYF1 | 54-259 | None |
| A0A1S8VQ56 | 65-315 | None |
| A0A068UIA9 | 13-229 | None |
| A0A6D2HG29 | 34-218 | None |
| A0A061RLR7 | 2-154 | None |
| A0A835ETF7 | 59-239 | None |
| A0A7V2T9E3 | 17-227 | None |
| A0A822XUI7 | 2-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.