DPCstruct | MC32512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 192 ± 13 aa |
| Standard deviation of domain lengths | 13.07 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 20.41 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0023- CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A564TI30 | 5-185 | RTFSFSDVKSLIARHNEIENKLEELKLTEQKYNDKIKKTTGLYSASEVLKILKDIPIEEVNRDKKGIRVKALRENGFTNYADIFTAS… |
| A0A229GNA5 | 1-198 | MPGQNLDRNAARQWLKIQIDKEPPILKQIAALHKEAQLNAFKARNAKKKRSAQDRLSNTPVTVLLRKRADVNPMVLLAAGVATADHI… |
| Q5YR93 | 56-251 | None |
| A0A7Y2QYU5 | 18-203 | None |
| A0A437UVD6 | 45-245 | None |
| A0A1H9UYH8 | 1-195 | None |
| A0A3N0IJP6 | 1-196 | None |
| A0A7J0D1J0 | 7-204 | None |
| A0A4R1L1U0 | 33-253 | None |
| A0A7H2BCP2 | 15-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.