DPCstruct | MC32511
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 154 ± 22 aa |
| Standard deviation of domain lengths | 21.97 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.03 |
| Pfam Score | 87.18 |
| Assigned Pfam label(s) | PF20929- CL0705 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813NUU4 | 7-150 | TINMNELTLKLEKYCDKSSYFISSSRSEQEFHELNIRSKNLKRILSRIPDDINEKREFLETIKEIASAIKKTLDSVSNTYQYFKTAD… |
| A0A034WRL4 | 12-169 | YDLVAAIIRRAELNVNLNEAVLRLQGNIAESDLHEYRLTRTEEPFQELNRKSVALKVILSRIPEEITDRKAFLETIKEIASAIKKLL… |
| A0A0D8YF80 | 129-311 | None |
| A0A6V7X0J0 | 76-232 | None |
| C4Q5Z1 | 38-211 | None |
| A0A672PFE7 | 7-178 | None |
| A0A2B4S9B9 | 28-207 | None |
| A0A182TRT9 | 1-126 | None |
| A0A7T8KDZ8 | 40-178 | None |
| A0A5K4E976 | 4-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.