DPCstruct | MC32510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 142 ± 25 aa |
| Standard deviation of domain lengths | 24.58 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.02 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | CL0172- PF04803 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q5SXC9 | 1-97 | MAGSRLETVGSVFSRTRDLMRAGVLKEKPLWYDIYKAFPPLREPVFRRPRLRYGKAKADIQDIFYQEDQIRAKFFATYGSGQKAFDL… |
| A0A034WQZ9 | 5-153 | RLEKIGTIFTRVNGLIKAGAMKYEDRPIWFDLYTAFPPKLEPRFDRPASDTKIKNIFYAEDVTRAKFHKRTKQNETINFLDTRRKTQ… |
| A0A7J6U1W0 | 12-207 | None |
| R1D5K3 | 17-175 | None |
| A0A7S2HVE9 | 20-174 | None |
| A0A820SKS5 | 3-141 | None |
| A0A438E368 | 1-121 | None |
| A0A5B6WBV6 | 6-175 | None |
| A0A1U8FDE3 | 1-128 | None |
| A0A0K0EHI2 | 7-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.