DPCstruct | MC32507
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 150 ± 28 aa |
| Standard deviation of domain lengths | 27.67 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.23 |
| Pfam Score | 93.17 |
| Assigned Pfam label(s) | PF05346- PF10712- PF00643- PF04640 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836J4X4 | 8-149 | MGNHEMGPPWLIPMLSASYFIPCAVHGESNKSECNMFCLDCMGSAFCSSCLIYHRDHRVVQIRRSSYHNVVRVNEMQKYIDISCVQT… |
| A0A067EBR2 | 3-134 | SSSSIIPRWLQILLAEKFFSPCVVHECANKNDKNIFCLDCCMSICLHCSHTHRPHHLLQVRRYVYHDVLRLGDAQKLMNCSFVQPYT… |
| A0A446Q8I2 | 175-284 | None |
| A0A6J1A441 | 8-134 | None |
| A0A4Y7L6Y1 | 8-149 | None |
| A0A194YNC2 | 13-158 | None |
| A0A0D9VD90 | 170-318 | None |
| A0A830CJQ5 | 2-127 | None |
| A0A1Z5RM67 | 13-131 | None |
| A0A6P5G8D7 | 1-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.