DPCstruct | MC3250
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 257 ± 39 aa |
| Standard deviation of domain lengths | 39.42 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4XBN4 | 265-514 | EDTIAFRERSQRVLENVLAGTYMDTDISDLPQTSSVKHPYITAPPFRKGYRPVLYQVVSTAWGTGVILEAKDFFTVGPDRRDLHCIV… |
| A0A7I4YKW9 | 28-326 | EIPHLEDTIDFRARSKQVMNQLLSGAYDEVDVANVSPSPAERLHSVKIPPVYKGIRPVLYQVVASGWGAGVILEAKDFFIMGPDRRD… |
| A0A368GEN4 | 44-335 | None |
| A0A6V7XZ52 | 293-556 | None |
| A0A6V7Y552 | 170-386 | None |
| A0A2H2HZG0 | 10-239 | None |
| A0A2H2ID80 | 174-381 | None |
| A0A2H2IL00 | 65-378 | None |
| A0A2H2IN58 | 235-551 | None |
| A0A6V7TL61 | 65-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.