DPCstruct | MC325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 186 ± 31 aa |
| Standard deviation of domain lengths | 30.73 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 29.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5H5R0 | 1-148 | MLSLSDDVRLPPPEIIVHDEHSVSAVVPRFFQEAPFDSIKPSFLYLLALFSKNGSECNSFGHIEAYHRNQDKCLLRIRVQMPKIDYT… |
| A0A183GPY5 | 1-186 | MLCGCVSGVAKGCERVNTFNVGDLKACKLLETSVVPKPIVRQQGSTSVSVTVERFFNQPPFDVLNPSRLTLLADFTTKEKAQCEDLP… |
| A0A0N5AW71 | 108-281 | None |
| A0A1I7YCL9 | 82-256 | None |
| A0A2G5UEL0 | 82-228 | None |
| A0A0K0EH79 | 78-321 | None |
| A0A368G377 | 27-228 | None |
| A0A3P7MU73 | 20-172 | None |
| A0A0N4YA69 | 37-217 | None |
| W2TV25 | 1-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.