DPCstruct | MC32499
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 108 ± 11 aa |
| Standard deviation of domain lengths | 11.27 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 39.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0127 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380DWL9 | 63-175 | LGIGIANKVLMLENSTYSVISPEGAAALLWKDSNLAKIAAETMKITAHDIKQLGIIDDVISEPLGGAHKDIEQQALAIKSAFVEQLD… |
| A0A843W7L3 | 9-140 | RVAEDQSPRRLGARLLTTVVLLTAAASAYDLICSPEACAAILWKSSKAAPKAAEKLRITATELCKLKIADGIILYETPFLQEPLGGA… |
| A0A538TA36 | 1-82 | None |
| A0A804IC38 | 205-329 | None |
| A0A2G2LN69 | 1-91 | None |
| A0A7X2SS52 | 87-197 | None |
| A0A1B0C5T1 | 1041-1160 | None |
| A0A832KFV8 | 55-171 | None |
| A0A835SES2 | 3-108 | None |
| A0A1A9Z173 | 201-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.