DPCstruct | MC32497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 167 ± 20 aa |
| Standard deviation of domain lengths | 20.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 53.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9G6N1 | 90-262 | PLNPQHFVAGRYTVPSGSVYGGLNDRLGIGDFYTSKAALSRLSLIPKLDSAGYRRLNSESAFKAQLTTQNIAYVENRLPFCVVTDRR… |
| A0A843VT41 | 11-144 | EYLVPEGSSYGGLNDRFDVGDQRASQMDTSGVRVTARRLPFHVLSDRRYAFPPGLHSVLVASMGSPGPLSGAKCKPCRPVCVGLCVE… |
| A0A4Y1QSE1 | 276-447 | None |
| A0A3L6QKB6 | 132-274 | None |
| A0A7J8V985 | 1-210 | None |
| A0A3Q7GCD7 | 600-767 | None |
| A0A803NBV1 | 190-361 | None |
| A0A176VWP0 | 304-463 | None |
| A0A4Y7J7E0 | 44-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.