DPCstruct | MC32492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 74 ± 9 aa |
| Standard deviation of domain lengths | 9.33 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 22.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P3W9Z1 | 168-237 | SGKETVIIGDDTSTYFEIPHQLNSIDVLIRVTRLSDGITVHCASKPTDENTIVISLKEPPQKDDYQVDIF |
| A0A2D8XJ60 | 97-164 | KPVYNPFQAWTQEYGAATWNITHNLGKFPTVTVVDDNGKIVYGDVTYNSNNSISISFSSSVDGKVYLN |
| B4CXS5 | 384-461 | None |
| A0A1Z1W4Z2 | 96-165 | None |
| A0A0F9NW44 | 4-76 | None |
| A0A142X0L4 | 42-119 | None |
| A0A6J4MNR7 | 136-233 | None |
| A0A094KU90 | 551-627 | None |
| A0A0F9SV02 | 1121-1208 | None |
| A0A3D5YZI4 | 173-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.