DPCstruct | MC32485
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 158 ± 23 aa |
| Standard deviation of domain lengths | 23.31 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Y9PZ97 | 257-382 | MEFGRRMAVERELEKVDAVRLINIVFDETGHFVLYGTMLGIKVINVETNRCVRILGKQENIRVMQLALFQGIAKKHRAATTIEMKAS… |
| A0A0A9XQL4 | 1-177 | MDPIAFGRAKNAVLEKERYLVGMSLGTIPGGRHTVPYPQALFDQSDLFLLYPSIVGIKVVNIRTKQVVRVLGRNESTVAHFSAIALF… |
| A0A183RUY0 | 5-142 | None |
| A0A0E9NB17 | 976-1098 | None |
| A0A0K0JR80 | 593-733 | None |
| A0A4Y9Z729 | 692-844 | None |
| A0A0P1ALK8 | 685-876 | None |
| A0A7S4E4Q0 | 27-200 | None |
| U6H028 | 2-176 | None |
| A0A6S7LN00 | 130-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.