DPCstruct | MC32481
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 100 ± 3 aa |
| Standard deviation of domain lengths | 2.74 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 85.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 43.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9XBA8 | 1-101 | MDEANAKKVAQLDAQLRDARDNLGDSEVREILFSKTNHYARIGDLEMCLKSNAECATKTLAAGPKLDLAFQRIRLGIAFSDNDIAAK… |
| A0A2P2LE96 | 70-162 | MRTKNEEELKKLDEKIADAEENLGESEVREAHLAKSLFYFRIGDKEKALEQLKVTETKTVAVGQKMDLVFYTLQIGFFYMDFDLISK… |
| A0A072TPE4 | 256-351 | None |
| A0A284RVM5 | 68-169 | None |
| A0A813FDF1 | 77-177 | None |
| C1BSX2 | 77-176 | None |
| A0A0D2XH43 | 120-222 | None |
| A0A7R9BTG4 | 73-174 | None |
| A0A821PHK2 | 2-99 | None |
| A0A1Y3N4S0 | 25-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.