DPCstruct | MC32477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 359 ± 48 aa |
| Standard deviation of domain lengths | 48.35 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0362 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C3NJE2 | 4-335 | ETFRIEIEPLSPTFVWSGETLYKGADFDLVNGKILIVDPFKALGKVKNLREIFKEQFVRTIKDFKLIFPSTSVPNQILMINEYLVPA… |
| A0A1F4NKX0 | 3-393 | AFLTTHRLHLTPLSPIHIGCGEDFEPTNYVIDDDVLYGFDPSRATLSDVQRGKLLDAANRASLLGLQRFFREHAAVFKPHAQVLIPV… |
| A0A496RFS4 | 2-357 | None |
| A0A350KLZ5 | 3-296 | None |
| A0A654RLX4 | 5-318 | None |
| A0A7V4HGV6 | 36-442 | None |
| A0A5C8PVK8 | 2-372 | None |
| A0A1G0F081 | 1-263 | None |
| A0A6N1YAD8 | 1-324 | None |
| A0A017T5Y2 | 9-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.