DPCstruct | MC32476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 204 ± 29 aa |
| Standard deviation of domain lengths | 29.35 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 19.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0661 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820UGU9 | 41-251 | EHPIEIIIPRDPNFIIPPMILHNVTKMYAPTQQFHFQTFNITQSNENLTVSLHFEMRPRNPSLNYLLILKFDGQPHLNGTIENIDDW… |
| A0A6P4XW23 | 274-471 | LSEEITIVLQNNPEIFRVGHLVNYKYYDNATMVLRQFTARENQTFGVTLTVRTTSYISSARIYGKMGGDPNDTDHDFSKLLTSDDFD… |
| Q2EG98 | 870-1092 | None |
| T1H990 | 199-382 | None |
| A0A818CMG1 | 2-161 | None |
| A0A1A9VG64 | 98-275 | None |
| A0A817HEC2 | 1-130 | None |
| A0A6J8DWY7 | 228-448 | None |
| A0A6J8DEH9 | 257-448 | None |
| A0A822BWN1 | 185-386 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.