DPCstruct | MC32472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 151 ± 29 aa |
| Standard deviation of domain lengths | 29.23 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0601 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645H0M6 | 1-159 | MTQLYGNRLVYKDHPRIMLRGMLDSLQAQLLELQLKASAGKAEKLVEELEEVLQYIRNILKCEVLEEEFPKINLLGLNEDELREWSH… |
| A0A820ST83 | 57-224 | ASSRTNKSPIVPKIYTRRGDRGTSTLLSSGANRLSKDSLIFDVLGTIDELSSTIENIQCALFEIGSCVAAENCSSHFEFNDAILIKH… |
| A0A0G0RF56 | 2-209 | None |
| A0A7R9W3A1 | 35-154 | None |
| A0A0C2SFJ6 | 156-317 | None |
| R9RBV0 | 26-160 | None |
| A0A1N6UIG5 | 50-235 | None |
| A0A4Q5UC30 | 30-144 | None |
| A0A661Q5N5 | 51-249 | None |
| A0A413PZA9 | 2-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.