DPCstruct | MC3247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 181 ± 25 aa |
| Standard deviation of domain lengths | 24.92 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4XWE7 | 4-198 | RDEWEQCIERELRRKLEIVEETPVRPTEKLIQQKLKHFGNKCHDAWDVIETSQREFTNMMHSYDEFLKERGGVLHFYVKLKTLFCEH… |
| A0A7I4Y6G2 | 1-160 | MDLREKLRTVQQQLPDLQRALPRLPSAQELHDNIVKYCIEFHDCTETVARLENHLRLLRNSQEPVLHRSQEAESLEWQSDLLRLRFL… |
| A0A3P7YCY6 | 496-652 | None |
| W2T3Z8 | 2-204 | None |
| A0A183FBJ4 | 2-222 | None |
| W6NTL5 | 40-199 | None |
| A0A0N4XP28 | 1-198 | None |
| A0A0C2CBK6 | 2-187 | None |
| A0A7I4Z424 | 1-165 | None |
| A0A183FTU6 | 833-1048 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.