DPCstruct | MC32469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 146 ± 21 aa |
| Standard deviation of domain lengths | 20.85 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B2G478 | 4-146 | LKDIDNWEYLENGNEVFFLYNIDPDYCMFLEEDDMNRNKVESYSLNQIRPTLSWNKLVLKFRDRTINEFMTVFLDGVRFMSVAPNLG… |
| A0A650A4R5 | 9-134 | ESVAESAYHEWIRFDGLGVWTYQPQVEIRLEREGQLGTVQQPWTNGFQATSTRHEYVLYYGDSPVEYHTIVGVDDSRAFVPDPQQPQ… |
| A0A1F2SWC7 | 103-236 | None |
| A0A7X8JVY4 | 169-320 | None |
| A0A7X2NMW9 | 2-131 | None |
| A0A1I7B615 | 8-117 | None |
| A0A7W2TWS6 | 32-183 | None |
| A0A644XNH5 | 1066-1198 | None |
| A0A6A9STV1 | 36-140 | None |
| W8QQL6 | 91-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.