DPCstruct | MC32468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 104 ± 6 aa |
| Standard deviation of domain lengths | 6.37 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 19.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A351Y5A7 | 1-104 | MPKLSTTVYKIENYELDVEKLIIEFSKRNEVVSSVNDANNVIVIITKTYQNIEWGKIREINDTIRNMYIFYMNTEQNLLFVNTTSKD… |
| A0A267TCU0 | 80-186 | MYAYKVKSKSWAWEKWTTVLDENICRYYINDEEKVLVVIEPKESNVGWTTQHNISNLSWELYVIYWNQNKNVAFVNATDKSLANKLV… |
| O54583 | 112-208 | None |
| A0A1E3VK59 | 171-259 | None |
| X6BI97 | 180-281 | None |
| A0A4Q1KIU6 | 530-641 | None |
| A0A375YP14 | 297-399 | None |
| A0A5J4RKE0 | 521-629 | None |
| A0A133XWX8 | 526-634 | None |
| J5GPD6 | 277-382 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.