DPCstruct | MC32466
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 95 ± 5 aa |
| Standard deviation of domain lengths | 5.00 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 57.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4SNC3 | 1-91 | MFEKGTHFNPVDLVCGVRDYKGNKFDLPQYVDKTTGFISHKSKNGKELKALELPGLWNGAMSDWNTVFVEVPLSTFNPVKTVNDLLR… |
| A0A7Y1T3H2 | 182-278 | NEKQSEIFNNSTHFNPVDLVCGIKNYKGEKFNLENYVDHKAAFITQKTVSGKDIKALELPGLWNGSMAHWNTIFVEVPLITFNPVKT… |
| R5HXM1 | 260-343 | None |
| A0A7X7AUD5 | 1-100 | None |
| A0A2P9H1K5 | 249-344 | None |
| A0A831KQE2 | 63-159 | None |
| A0A3D6DEY9 | 130-229 | None |
| A0A3D3A5D1 | 39-127 | None |
| A0A2A4R3A2 | 575-671 | None |
| A0A7Y2F445 | 375-475 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.