DPCstruct | MC32464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 223 ± 23 aa |
| Standard deviation of domain lengths | 22.54 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04782 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9C0H5 | 2-203 | KEVEILFFRACESGKEVSRVLEEDKVQFRPLLPEEITHESKPSGFLATFFACCWEDVAILESPPLAEIKYLTWHKSVSPQLSPSRDR… |
| A0A453LIZ9 | 4-174 | EIKAQFERASSSAGEVSKMLEVGKMPYYQKGSGFKVSAMMICGIPTMEEEFLRFEEDKAMGCGNLSSTLQKLYMWERKLLQEVKAEE… |
| A0A830C5T2 | 138-351 | None |
| B9RJ22 | 2-194 | None |
| A0A6V7NS32 | 2-189 | None |
| A0A834ZC73 | 379-616 | None |
| A0A830C184 | 296-540 | None |
| A0A453I6V9 | 1-224 | None |
| A0A7C8Z5M0 | 184-396 | None |
| A0A1U8AG99 | 325-570 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.