DPCstruct | MC32461
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 282 ± 68 aa |
| Standard deviation of domain lengths | 68.31 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 80.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9BBW6 | 91-407 | DDIGFEDLSRYCHVLRSREIYVNPSRQMTPDDGDRLYERLRDLRLRDFKILIGLNPDDPTDIIPIREVFKWEDPSKPVGGDSIFDWT… |
| A0A446SD94 | 28-331 | KLTNEELDEQDLRHALYRLRSYKHKLKEEGKEDTFGLKDISEADCDQEFLKKQRFFRRFEEISTLDWYFHPDYCKGGSLNDYQRLVL… |
| A0A3B5YSB0 | 66-394 | None |
| A0A3L6SMQ6 | 18-187 | None |
| N1R2F8 | 437-710 | None |
| R7W6M7 | 72-380 | None |
| A0A4U6U2X3 | 148-475 | None |
| A0A811MZQ5 | 19-282 | None |
| A0A446JWI7 | 29-275 | None |
| A2Y5E7 | 12-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.